Rabbit Anti-Munc18-1 Antibody 353279 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-Munc18-1 Antibody

All lanes: Munc18-1 at 0.5ug/ml Lane 1: Rat Brain Tissue Lysate at 50ug Lane 2: Mouse Brain Tissue Lysate at 50ug Lane 3: PANC Whole Cell Lysate at 40ug Lane 4: HEPG2 Whole Cell Lysate at 40ug Lane 5: HELA Whole Cell Lysate at 40ug Predicted bind size: 67KD Observed bind size: 67KD
Rabbit Anti-Munc18-1 Antibody

IHC(P): Mouse Brain Tissue
Rabbit Anti-Munc18-1 Antibody

IHC(P): Rat Brain Tissue
Rabbit Anti-Munc18-1 Antibody

IHC(P): Human Glioma Tissue

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-Munc18-1 Antibody

The Rabbit Anti-Munc18-1 Antibody from United States Biological is a Rabbit Polyclonal antibody to STXBP1. This antibody recognizes Homo Sapiens, Human, Mouse, and Rat antigen. The Rabbit Anti-Munc18-1 Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-Munc18-1 Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number353279
Antibody TypePrimary
ReactivityHu, Mo, Rt
FormatSupplied as a lyophilized powder in 5mg BSA, 0.9mg sodium chloride, 0.2mg Na2HPO4, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to ~0.5mg/ml
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to aa184-216, KEYPAVRYRGEYKDNALLAQLIQDKLDAYKADD, of human Munc18-1 at N-terminal
TargetMunc18-1
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Namesyntaxin binding protein 1
NCBI Gene AliasesDEE4, MUNC18-1, N-Sec1, NSEC1, P67, RBSEC1, UNC18, unc-18A, unc18-1
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!